PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g041667m
Common NameCISIN_1g041667mg, LOC102611148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 660aa    MW: 72979.9 Da    PI: 6.9078
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g041667mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS359.35.5e-1102856592374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        +++++e+A+avs+g+   a+++L+rls+  +++g++ qRl  ++  AL++r++       +  +p + +e   +e++ +++l+++ sP++ +
  orange1.1g041667m 285 KQTVIEAATAVSEGKYDVASEILTRLSQATNSKGNSEQRLMEHMCSALKSRVNP------HE-NPPPVAELFGKEHAESTQLLYDFSPCFSL 369
                        57899************************************************9......22.33333334599****************** PP

               GRAS  94 shltaNqaIleavege........ervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                        ++++aN aIlea+ ++        +++H+iDfdi+qG+Q+++L++aL++R +g+p  +++T+v++  + s+e+l++++++L+++Ae++gv +
  orange1.1g041667m 370 GFMAANLAILEATMEQttgntigsNKIHVIDFDIGQGGQYMNLFHALSARLNGKPaIVKVTAVAD-GTASEEKLKAVRDKLSQVAERVGVCL 460
                        ************988778878888999************************7777699*******.567*********************** PP

               GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                        +fnv ++ +++dl+ ++L ++p+E+laVn++++l+r++desvs+e++rde+L+ vk+lsP vv++veqe+++n+++F++r+ ea+ yy alf
  orange1.1g041667m 461 RFNVAICLKFDDLSRDSLGCEPDETLAVNFAFKLFRMPDESVSTENPRDELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALF 552
                        ****9999************************************************************************************ PP

               GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrveeesgsl 358
                        ds+e+++ r++++r+kvE+  l+r++ n vaceg++r+er+e ++kWr+r+++aGF+  p+s+ +a+++++ l+  +  + g++v+ee+g +
  orange1.1g041667m 553 DSIESTVLRDHSDRVKVEEG-LSRKLANSVACEGRDRVERCEVFGKWRARMRMAGFELKPMSQIIAESMRTRLSSGNrvNPGFTVKEENGGI 643
                        ********************.*************************************************99988776789*********** PP

               GRAS 359 vlgWkdrpLvsvSaWr 374
                        ++gW++r+L++vSaWr
  orange1.1g041667m 644 CFGWMGRTLTVVSAWR 659
                        ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.594258637IPR005202Transcription factor GRAS
PfamPF035141.9E-107285659IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MSSGFPGGGG GGPDLYSGLA AGGRSITMNG NQLSHQPSYR SSQLPGIFMD QMTSSPQIAN  60
RNLIGKRTFN DYQITHHHHQ QQQQLFQQNH INPAMNSLFL RSVKPRTYQN LSPISPLDFS  120
PNNINNNNNN VLSPDLQQSL PLSHRYNLPL LQQQLQQQQQ PRLYQQHQQQ QHVALVSNTI  180
PYVDNNNTVP SYNNRVQVQG QESEKKMLNR LQELEKQLLD DEEEGDDVSV ITNTNSEWSE  240
TIQNLITFSP KQTVSSIRPL APSPTTSSSS CSSSSVASPA TSCSKQTVIE AATAVSEGKY  300
DVASEILTRL SQATNSKGNS EQRLMEHMCS ALKSRVNPHE NPPPVAELFG KEHAESTQLL  360
YDFSPCFSLG FMAANLAILE ATMEQTTGNT IGSNKIHVID FDIGQGGQYM NLFHALSARL  420
NGKPAIVKVT AVADGTASEE KLKAVRDKLS QVAERVGVCL RFNVAICLKF DDLSRDSLGC  480
EPDETLAVNF AFKLFRMPDE SVSTENPRDE LLRRVKGLSP SVVTLVEQET NTNTAPFMAR  540
VNEACAYYGA LFDSIESTVL RDHSDRVKVE EGLSRKLANS VACEGRDRVE RCEVFGKWRA  600
RMRMAGFELK PMSQIIAESM RTRLSSGNRV NPGFTVKEEN GGICFGWMGR TLTVVSAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4328265910375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.38030.0callus| flower| fruit| vegetative meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006490660.10.0PREDICTED: scarecrow-like protein 8
SwissprotQ9FYR70.0SCL8_ARATH; Scarecrow-like protein 8
TrEMBLA0A067ESB80.0A0A067ESB8_CITSI; Uncharacterized protein
STRINGPOPTR_0004s07700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43502856
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-171SCARECROW-like 8